PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00284g00619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 364aa    MW: 41444.7 Da    PI: 6.9823
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00284g00619.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.8e-3179132255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               prlrWtpeLH rFv+ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ++R+
  Peaxi162Scf00284g00619.1  79 PRLRWTPELHLRFVHAVERLGGQDRATPKLVLQLMGIKGLSIAHVKSHLQMFRS 132
                               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.89775135IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2975133IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1576134IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2279134IPR006447Myb domain, plants
PfamPF002491.5E-980130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNGGSNREEY SNLSPKNQIE SEEETEEEEE EEKEDDEETE ENNSKPKGTR TSSSNSTVEE  60
SGKKTNSGNV RQYVRSKTPR LRWTPELHLR FVHAVERLGG QDRATPKLVL QLMGIKGLSI  120
AHVKSHLQMF RSKKTDDPNQ ISTDVRFLLE NGDHHIFNLS QLPRIQGFNQ TSTSSLRYGD  180
ALWNRQPNSM YNPYMNNGGA SSISTTRHGF TSHINIGHSS HGQLFPWKTL DIEKNQNRPQ  240
YNFPNQRLWQ GQMGTSSSKQ NLLMTLPINR DRDRKGWMST EEAAAATKTT TNKRKIQDSE  300
INLDLNLSLK TRREEDDHKR LKAEEVGNLL SLSLFSSTTS VDQENHDGGE KNTRIMASTL  360
DLTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-40HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791664.11e-156PREDICTED: uncharacterized protein LOC104238869 isoform X2
TrEMBLM1CY221e-129M1CY22_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000772171e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-50G2-like family protein